PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_53.53
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family MYB
Protein Properties Length: 1196aa    MW: 131048 Da    PI: 5.8506
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_53.53genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.57.3e-09797838346
                                  SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
              Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                  +WT eE e++ d  + +G++ +++Ia+ +  ++t  +c+++++k
  evm.model.supercontig_53.53 797 PWTSEEREIFMDKLAIFGKD-FRKIASFLD-HKTTADCVEFYYK 838
                                  8*****************99.*********.***********98 PP

2Myb_DNA-binding33.11.3e-1010151055345
                                   SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
              Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45  
                                    WT eE  ++++av  +G++ + +I+r++  +R++ qck ++ 
  evm.model.supercontig_53.53 1015 DWTDEEKSIFIQAVSSYGKD-FVKISRCVR-TRSRDQCKVFFS 1055
                                   5*****************99.*********.********8776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.39E-14781841IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-5789839IPR009057Homeodomain-like
PROSITE profilePS5129315.607793844IPR017884SANT domain
SMARTSM007173.7E-8794842IPR001005SANT/Myb domain
PfamPF002496.4E-6796838IPR001005SANT/Myb domain
PROSITE profilePS5129312.41810111062IPR017884SANT domain
SMARTSM007171.2E-910121060IPR001005SANT/Myb domain
SuperFamilySSF466897.41E-1110131062IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-610151056IPR009057Homeodomain-like
PfamPF002491.5E-810151055IPR001005SANT/Myb domain
CDDcd001678.23E-810161054No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1196 aa     Download sequence    Send to blast
MPPEPLPWDR KDFPKERKHE RSESSLGPVA RWRDSSTMSS SSHHVSREFA RWGSADFRRP  60
GHGKQGGLHL FTDDNWVYGH APRSSDKMFE DENCRLSVSR GDGKYSRSNR ENRGSSNQRD  120
WKGHSWEIGN GSPSTLGRPH DGNNDQRMDD ILTCQSHPHS DSANTWEKDQ HDNKLSGVSG  180
LGTGQRCERE NSLGSMDWKP LKWTRSGSLS SRGSGFSHSS SSKSLGGVES SEAKTELLVK  240
NATPIQSPSG DVAACVTSAV PLEETSSRKK PRLGWGEGLA KYEKKKVEGP DVTINKDGAA  300
VSTHNTETRS LCSNSADKSP RVMSFADCAS PATPSSVACS SSPGVEEKSF GKAVNVDNDI  360
SNLCSSPSLG SHNQIEGSSF SLEKLDIISI VNLGCSLTEL LQSDDSGSVD SSFVRTTAMS  420
KLLVWKGDIL KTLEVTESEI DSLENELKVL KSQSGDLCPC PAISCSLLVE GKVNAGKEQD  480
SASSLIQRPA PLEIDSCMDV EVEKVPVCNG ALQSTLVDAK KEDIDSPGTA TSKFVEPLSL  540
LNDVSPPEMV KSAECSTSVE AIEPMNPVPS SKEENHASGC ADDSLIMNNK DDAPVPSGTN  600
LYADICDSIL ASNKEVASKA SEECNKLLPS KNCHVDVLGA TYISSWQDNP FIKERFAKRK  660
HFLRFKERVL TLKFRAFQHL WKEDVRLTSI RRFRAKSHKK CELSLRTVNG GYQKYRSSIR  720
SRFSSPAGNL SLVPTMEVVN FTSKLLSDSQ VKHYRDGLKM PELILDEKEK VSSRFISRNG  780
LVEDPCAVEK ERAMINPWTS EEREIFMDKL AIFGKDFRKI ASFLDHKTTA DCVEFYYKNH  840
KSDCFGKTKK KLGLTEQWRS SATTYLVPSV KKWNREMNAV SLDLLGAASA MAARADNVTC  900
NQQISSGRVF FRGRSESRSS RHDDSLIERS GSFDILGNER ETVAADVLAG ICGSLSSEAM  960
SSCITSSIDP AEGCRDSKCQ KMDSAIKRSS TSDITENVDD DTCSDESCGD MDPTDWTDEE  1020
KSIFIQAVSS YGKDFVKISR CVRTRSRDQC KVFFSKARKC LGLDSIQSVS QNGGTPLSDD  1080
VNGGGSDMED AYIMETSSAI CNNQLGAKID EDLPSCVLNI NQDESDTVGT IKLQTNLNSS  1140
SEDKRVGLSS DHKEAEACQT EDKPDLVLEN GSDIMNVTSA EMLSASAQPR KMRLF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C3e-14760845993NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D3e-14760845993NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007009785.10.0Duplicated homeodomain-like superfamily protein isoform 1
TrEMBLA0A061FMP20.0A0A061FMP2_THECC; Duplicated homeodomain-like superfamily protein isoform 1
STRINGVIT_13s0019g04010.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52602744
Representative plantOGRP32151725
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.10.0MYB family protein